DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and osr1

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001006079.1 Gene:osr1 / 450059 ZFINID:ZDB-GENE-070321-1 Length:264 Species:Danio rerio


Alignment Length:75 Identity:35/75 - (46%)
Similarity:49/75 - (65%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
            |...:.|.||:||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|    
Zfish   165 RLPSKTKKEFVCKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 228

  Fly    78 ---MDTCGRG 84
               ...||:|
Zfish   229 PFKCQECGKG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 9/19 (47%)
osr1NP_001006079.1 zf-C2H2 174..196 CDD:278523 15/21 (71%)
C2H2 Zn finger 176..196 CDD:275368 14/19 (74%)
zf-H2C2_2 188..213 CDD:290200 14/25 (56%)
C2H2 Zn finger 204..224 CDD:275368 9/19 (47%)
zf-H2C2_2 216..239 CDD:290200 8/23 (35%)
C2H2 Zn finger 232..252 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.