powered by:
Protein Alignment drm and bowl
DIOPT Version :9
Sequence 1: | NP_001285590.1 |
Gene: | drm / 49638 |
FlyBaseID: | FBgn0024244 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245861.1 |
Gene: | bowl / 33602 |
FlyBaseID: | FBgn0004893 |
Length: | 744 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 39/74 - (52%) |
Similarity: | 52/74 - (70%) |
Gaps: | 8/74 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 RKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH----- 77
|..|||.:||||:|.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:|
Fly 230 RASRPKKQFICKFCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKEKP 293
Fly 78 --MDTCGRG 84
...||:|
Fly 294 FKCTECGKG 302
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45444251 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000748 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.