DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and bowl

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001245861.1 Gene:bowl / 33602 FlyBaseID:FBgn0004893 Length:744 Species:Drosophila melanogaster


Alignment Length:74 Identity:39/74 - (52%)
Similarity:52/74 - (70%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH----- 77
            |..|||.:||||:|.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:|     
  Fly   230 RASRPKKQFICKFCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKEKP 293

  Fly    78 --MDTCGRG 84
              ...||:|
  Fly   294 FKCTECGKG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 10/19 (53%)
bowlNP_001245861.1 COG5048 <232..372 CDD:227381 38/72 (53%)
C2H2 Zn finger 240..260 CDD:275368 14/19 (74%)
zf-H2C2_2 252..277 CDD:290200 16/25 (64%)
C2H2 Zn finger 268..288 CDD:275368 10/19 (53%)
zf-H2C2_2 280..303 CDD:290200 8/23 (35%)
C2H2 Zn finger 296..316 CDD:275368 3/7 (43%)
zf-C2H2 322..344 CDD:278523
C2H2 Zn finger 324..344 CDD:275368
zf-H2C2_2 336..361 CDD:290200
C2H2 Zn finger 352..372 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.