DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and Osr2

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:XP_017450351.1 Gene:Osr2 / 315039 RGDID:1305812 Length:312 Species:Rattus norvegicus


Alignment Length:75 Identity:36/75 - (48%)
Similarity:49/75 - (65%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
            |...:.|.|||||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|    
  Rat   163 RLPSKTKKEFICKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 226

  Fly    78 ---MDTCGRG 84
               ...||:|
  Rat   227 PFKCQECGKG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 9/19 (47%)
Osr2XP_017450351.1 C2H2 Zn finger 174..194 CDD:275368 14/19 (74%)
zf-H2C2_2 186..211 CDD:404364 14/25 (56%)
C2H2 Zn finger 202..222 CDD:275368 9/19 (47%)
zf-H2C2_2 214..237 CDD:404364 8/23 (35%)
C2H2 Zn finger 230..250 CDD:275368 3/7 (43%)
COG5048 251..>312 CDD:227381
C2H2 Zn finger 258..278 CDD:275368
C2H2 Zn finger 286..306 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.