DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and odd-2

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_509032.1 Gene:odd-2 / 183219 WormBaseID:WBGene00003846 Length:254 Species:Caenorhabditis elegans


Alignment Length:74 Identity:41/74 - (55%)
Similarity:52/74 - (70%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLHM---- 78
            |..|||.|||||||.|.|||.|||:|||||| :.|..|||:||||.|:::|:||.|:.:|.    
 Worm   116 RAARPKKEFICKYCDRHFTKSYNLLIHERTH-TDERPYSCDVCGKAFRRQDHLRDHKYIHQKDRP 179

  Fly    79 ---DTCGRG 84
               :.||:|
 Worm   180 FKCEICGKG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 15/19 (79%)
C2H2 Zn finger 57..77 CDD:275368 10/19 (53%)
odd-2NP_509032.1 zf-C2H2 124..146 CDD:278523 17/21 (81%)
C2H2 Zn finger 126..146 CDD:275368 15/19 (79%)
zf-H2C2_2 138..163 CDD:290200 17/25 (68%)
C2H2 Zn finger 154..174 CDD:275368 10/19 (53%)
zf-H2C2_2 166..189 CDD:290200 7/23 (30%)
zf-C2H2 180..202 CDD:278523 3/9 (33%)
C2H2 Zn finger 182..202 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.