powered by:
Protein Alignment drm and odd-1
DIOPT Version :9
Sequence 1: | NP_001285590.1 |
Gene: | drm / 49638 |
FlyBaseID: | FBgn0024244 |
Length: | 88 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498552.2 |
Gene: | odd-1 / 181893 |
WormBaseID: | WBGene00003845 |
Length: | 242 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 39/73 - (53%) |
Similarity: | 50/73 - (68%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 KMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH------ 77
:.|||.|||||||.|.|||.||||||||||.: |..:.||.|||.|:::|:||.|:.:|
Worm 121 RKRPKKEFICKYCARHFTKSYNLMIHERTHTN-ERPFHCETCGKSFRRQDHLRDHKYIHAKEKPH 184
Fly 78 -MDTCGRG 84
.:.||:|
Worm 185 KCEICGKG 192
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160163588 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000748 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.