DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and odd-1

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:73 Identity:39/73 - (53%)
Similarity:50/73 - (68%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH------ 77
            :.|||.|||||||.|.|||.||||||||||.: |..:.||.|||.|:::|:||.|:.:|      
 Worm   121 RKRPKKEFICKYCARHFTKSYNLMIHERTHTN-ERPFHCETCGKSFRRQDHLRDHKYIHAKEKPH 184

  Fly    78 -MDTCGRG 84
             .:.||:|
 Worm   185 KCEICGKG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 16/19 (84%)
C2H2 Zn finger 57..77 CDD:275368 10/19 (53%)
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 16/19 (84%)
zf-H2C2_2 142..167 CDD:290200 16/25 (64%)
C2H2 Zn finger 158..178 CDD:275368 10/19 (53%)
zf-H2C2_2 170..193 CDD:290200 7/23 (30%)
C2H2 Zn finger 186..206 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.