DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and OSR1

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_660303.1 Gene:OSR1 / 130497 HGNCID:8111 Length:266 Species:Homo sapiens


Alignment Length:75 Identity:35/75 - (46%)
Similarity:49/75 - (65%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
            |...:.|.||:||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|    
Human   166 RLPSKTKKEFVCKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 229

  Fly    78 ---MDTCGRG 84
               ...||:|
Human   230 PFKCQECGKG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 9/19 (47%)
OSR1NP_660303.1 zf-C2H2 175..197 CDD:306579 15/21 (71%)
C2H2 Zn finger 177..197 CDD:275368 14/19 (74%)
zf-H2C2_2 189..214 CDD:316026 14/25 (56%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)
zf-H2C2_2 217..240 CDD:316026 8/23 (35%)
C2H2 Zn finger 233..253 CDD:275368 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.