DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drm and OSR2

DIOPT Version :9

Sequence 1:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster
Sequence 2:NP_001273770.1 Gene:OSR2 / 116039 HGNCID:15830 Length:433 Species:Homo sapiens


Alignment Length:75 Identity:36/75 - (48%)
Similarity:49/75 - (65%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RRKMRPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH---- 77
            |...:.|.|||||:|.|.|||.|||:|||||| :.|..|:|::|.|.|:::|:||.||.:|    
Human   284 RLPSKTKKEFICKFCGRHFTKSYNLLIHERTH-TDERPYTCDICHKAFRRQDHLRDHRYIHSKEK 347

  Fly    78 ---MDTCGRG 84
               ...||:|
Human   348 PFKCQECGKG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 14/19 (74%)
C2H2 Zn finger 57..77 CDD:275368 9/19 (47%)
OSR2NP_001273770.1 COG5048 <293..428 CDD:227381 33/66 (50%)
C2H2 Zn finger 295..315 CDD:275368 14/19 (74%)
zf-H2C2_2 307..332 CDD:290200 14/25 (56%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 8/23 (35%)
C2H2 Zn finger 351..371 CDD:275368 3/7 (43%)
zf-C2H2 377..399 CDD:278523
C2H2 Zn finger 379..399 CDD:275368
zf-H2C2_2 391..416 CDD:290200
C2H2 Zn finger 407..427 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.