DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP4B and CG33310

DIOPT Version :9

Sequence 1:NP_000696.1 Gene:ATP4B / 496 HGNCID:820 Length:291 Species:Homo sapiens
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:328 Identity:57/328 - (17%)
Similarity:112/328 - (34%) Gaps:115/328 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    16 EFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSP 80
            |::|..:|...|:...|..|.|:: :|.:...|::...:|::..:..::. |........::..|
  Fly   583 EWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWFDFIKD-DASRKVPMIKMAQP 645

Human    81 GVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAP 145
            .::..|                                 ..|.....::           ||...
  Fly   646 FISFTP---------------------------------IGPRTNPKAV-----------SFDPR 666

Human   146 NHTKFSCKFTADM--------------LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSA 196
            |.|:...|:...|              ...|:  |:..||:..|:||..:|:|||:.|    .:.
  Fly   667 NSTEVMEKYAGIMALLEKYGDYGHNPRFGTCT--ANEKFGYPSGEPCVFLKVNRIIGF----KTE 725

Human   197 PRVDC-----AFLDQPR---------------------------ELGQPLQVKYYPPNGTFS--- 226
            |.::.     |.:|:..                           :..:.:.::::|.....:   
  Fly   726 PYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYT 790

Human   227 -----LHYFPYYGKKA--QPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYE--GK 282
                 :.|....|||:  .|:..|.:||.|:.|:..|..|.|.||:.|:::     |...|  |:
  Fly   791 DIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI-----HHRKEGYGQ 850

Human   283 VEF 285
            |.|
  Fly   851 VSF 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP4BNP_000696.1 Na_K_ATPase_bet 2..291 CDD:273446 57/328 (17%)
immunoglobulin-like 194..291 25/136 (18%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 31/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.