DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OMD and CG18095

DIOPT Version :9

Sequence 1:NP_005005.1 Gene:OMD / 4958 HGNCID:8134 Length:421 Species:Homo sapiens
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:311 Identity:84/311 - (27%)
Similarity:140/311 - (45%) Gaps:47/311 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    60 LGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSH 124
            ||.::......|..|.:     .:|:....| .:|||.|::|.|..:..:||...:|||.:.|:.
  Fly   110 LGALTNLDLSHNMLSKL-----SVKSFEQYP-QLQQLDLRYNRISQIENDSFDGLSHLKHLYLNG 168

Human   125 NKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEF---PFPLPKSLERLLLGYNEISKLQTNAMDGLV 186
            |::  ..||...|..|..|..|.|:||.:|..   .|.....|..|.|..|.:|.||..:..||.
  Fly   169 NQL--AHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLA 231

Human   187 NLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMP----PGLPSSLMYLSLENNSISS 247
            .|..|:|..|.|..  |:..:|:|..:|..|:|..|.:..:.    .|| .||..|::.:|.:..
  Fly   232 RLVHLNLSSNLLQK--LEPFVFSKNFELQDLDLSYNNITKLNKEALSGL-DSLERLNISHNYVDK 293

Human   248 IPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEI 312
            |.::..|.|..|..|.:|.|.|..:|.|:                   |:....||.:.|.||:|
  Fly   294 IYDESLDSLIALLQLDISFNLLTTLPDNL-------------------FHFNTQLEEIILANNKI 339

Human   313 EKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIH--TIY 361
            |:::..:|      .:.:||.||::..|.:.:  ::::....|.::  |:|
  Fly   340 EEISSQMM------FNQNHLRYIKLSGNAISD--AAFLDRLSPSVNRFTLY 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OMDNP_005005.1 NEL <68..>305 CDD:330839 68/243 (28%)
LRR 1 92..113 8/20 (40%)
leucine-rich repeat 94..116 CDD:275380 8/21 (38%)
LRR 2 116..129 5/12 (42%)
leucine-rich repeat 117..142 CDD:275380 8/24 (33%)
LRR 3 142..164 7/24 (29%)
leucine-rich repeat 143..163 CDD:275380 7/22 (32%)
leucine-rich repeat 164..187 CDD:275380 9/22 (41%)
LRR 4 165..184 6/18 (33%)
LRR 5 187..210 7/22 (32%)
leucine-rich repeat 188..213 CDD:275380 8/24 (33%)
LRR 6 213..233 6/23 (26%)
leucine-rich repeat 214..234 CDD:275380 6/23 (26%)
LRR 7 234..255 5/20 (25%)
leucine-rich repeat 235..258 CDD:275380 6/22 (27%)
LRR 8 258..280 7/21 (33%)
leucine-rich repeat 259..281 CDD:275380 7/21 (33%)
LRR 9 281..294 0/12 (0%)
leucine-rich repeat 282..301 CDD:275380 1/18 (6%)
LRR 10 301..321 7/19 (37%)
LRR 11 331..353 5/21 (24%)
leucine-rich repeat 332..356 CDD:275380 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..421
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566 3/12 (25%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380 1/1 (100%)
leucine-rich repeat 113..136 CDD:275380 4/28 (14%)
LRR_RI 115..384 CDD:238064 82/306 (27%)
LRR_8 135..195 CDD:290566 23/62 (37%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 8/24 (33%)
LRR_8 184..243 CDD:290566 20/58 (34%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 9/22 (41%)
LRR_8 232..289 CDD:290566 17/59 (29%)
leucine-rich repeat 233..256 CDD:275380 8/24 (33%)
leucine-rich repeat 257..280 CDD:275380 6/23 (26%)
LRR_8 280..339 CDD:290566 20/77 (26%)
leucine-rich repeat 281..304 CDD:275380 6/22 (27%)
leucine-rich repeat 305..328 CDD:275380 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45712
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.