DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(2)ltoPP43 and RDM4

DIOPT Version :9

Sequence 1:NP_524940.1 Gene:fs(2)ltoPP43 / 49505 FlyBaseID:FBgn0004811 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_180587.2 Gene:RDM4 / 817578 AraportID:AT2G30280 Length:346 Species:Arabidopsis thaliana


Alignment Length:370 Identity:92/370 - (24%)
Similarity:157/370 - (42%) Gaps:87/370 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAVVRIKRRIDEEPQTAFVLN-----GKRRRLHNDENALEDAGAVAGAVAGAVASDK-------- 53
            |.:||:||::.:....||.|.     .||..|...:.::.|:|....:||..|...|        
plant    17 PVIVRVKRKVGQSLLDAFWLEINERPLKRPTLDFSKLSISDSGERGPSVAEDVKPKKVLVRHLET 81

  Fly    54 --DELTT---VLKFAGTLEKQDDCATRKFAAARLNKAAARDLVQQQRSNDAAIASALRRDRQRQE 113
              |..||   :..|..:...:..|:..||...::  |..:|..::||         |.:..|:|:
plant    82 VTDSETTADIIHSFFESDHNEKSCSKGKFEERKI--AFKKDNRKEQR---------LTKSVQKQQ 135

  Fly   114 -AQENSREQRFRVVNCLRSTLENSAAEAECPESQSHESSSHITIVDIESQQQQHMGTASAAAEEQ 177
             |.||:|.::.     .||...|        :...||......::.:::::::.......:.|:|
plant   136 IASENARFEQI-----WRSRKGN--------KEGIHEKCHFFDVIRVDTEERRDNAQEFTSLEDQ 187

  Fly   178 QQ--------QEIAPSQDQQQPADSDVG----YVYDLYVPENEMQAAYVDMMDDNYLSVIPVGEI 230
            :.        :|..|:..::..||....    ||||.|....||     |:.:|:..:..|:  :
plant   188 KMLASFLPLLRECIPTAAEEIEADIQSSHTEEYVYDYYAVNEEM-----DISEDSSKNQFPL--V 245

  Fly   231 VLED----CYNDQDEDYDSEDSNQENYFTNDYPDDDEAGAMGSDDELCRQMNKFMLDDDEDEF-- 289
            ::||    |....:.||||||||.|::...|||:::|......||           |||:||.  
plant   246 IVEDEEEFCDGSDESDYDSEDSNAEDHPKTDYPEEEEEEEEEDDD-----------DDDDDESEE 299

  Fly   290 ----ASTSDDDDYATFRDPYVHTI--DTEEDSFVDDVDFYNVDRE 328
                ||...||:..:.|  :|.::  |.|.|.:.:||..|:...|
plant   300 EKSEASDESDDEETSKR--HVRSVLGDDEFDDYAEDVYGYSESDE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(2)ltoPP43NP_524940.1 DUF1762 194..262 CDD:285743 25/75 (33%)
RDM4NP_180587.2 DUF1762 218..278 CDD:285743 23/66 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I2417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.