DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fs(2)ltoPP43 and iwr1

DIOPT Version :9

Sequence 1:NP_524940.1 Gene:fs(2)ltoPP43 / 49505 FlyBaseID:FBgn0004811 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_593398.1 Gene:iwr1 / 2541789 PomBaseID:SPAC23H4.08 Length:277 Species:Schizosaccharomyces pombe


Alignment Length:329 Identity:83/329 - (25%)
Similarity:131/329 - (39%) Gaps:94/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-AVVRIKRRIDEEPQTAFVLNGKRRRLHNDENALEDAGAVAGAVAGAVASDKDELTTVLKFAG 64
            || .|:|:||:..|:|..|..|     .|.|:.|              :|:|.|..     ||||
pombe     1 MPLPVLRVKRKASEDPVNALYL-----ELGNNPN--------------SVSSTKRR-----KFAG 41

  Fly    65 --------TLEKQDDCATRKFAAARLNKAAARDLVQQQRS-NDAAIASALRRDRQR----QEAQE 116
                    || ||||      ...::|..::....:..|: :.....|:|:::...    |.:::
pombe    42 RYYFKLSQTL-KQDD------RYIQINDESSEPTHEDVRNIHSHTKISSLKKNNYGIPVVQTSED 99

  Fly   117 ----------NSREQRFRVV--NCLRSTLENSAAEAECPESQSHESSSHITIVDIESQQQQHMGT 169
                      .|||....::  :..|.|::|      .|.:||:.      :.|....:|.|...
pombe   100 VVKAPTHMDLGSRENTKGILSFSSPRYTIQN------LPSTQSNR------VFDAIRVEQGHTTY 152

  Fly   170 ASAAAEEQQQQEIAPSQD---QQQPADSDVGYVYDLYVPE----NEMQAAY--VDMMD--DNYLS 223
            ......:...||...:.|   ||...|    ||||:|...    |:...||  :|.:.  |.:.|
pombe   153 HPHPQLDSMIQEYLSNGDLPLQQSTED----YVYDIYEASSKEPNKPTFAYGVIDALSIPDAFRS 213

  Fly   224 VIPVGEIVLEDCYNDQDE---DYDSEDSNQENYFTNDYPDDDEAGAMGSDDELCRQMNKFMLDDD 285
            .:. .|:|.|...:|:|:   |...||||.|:::.|.|||:||......:||....      ||.
pombe   214 SLE-QELVSETVDSDKDDPLHDEIDEDSNAESFYQNSYPDEDEWQDSSENDEFAYS------DDA 271

  Fly   286 EDEF 289
            |.:|
pombe   272 EQDF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fs(2)ltoPP43NP_524940.1 DUF1762 194..262 CDD:285743 26/78 (33%)
iwr1NP_593398.1 DUF1762 176..254 CDD:285743 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106713
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.