DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and gcvT

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_417381.1 Gene:gcvT / 947390 ECOCYCID:EG11442 Length:364 Species:Escherichia coli


Alignment Length:373 Identity:75/373 - (20%)
Similarity:127/373 - (34%) Gaps:143/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RRTLR-LLGNDMRKVKEFFVPKEPETEKVPIPTQSQFHFSGERDKSKEATVPDDFQTHCDVLIIG 104
            |..|| ||.||:.|:                            .||.:|       .:..:|...
E. coli    63 REFLRYLLANDVAKL----------------------------TKSGKA-------LYSGMLNAS 92

  Fly   105 GGGVGSSIAY---------------------WLKEKA---------RDGLNVVVVEKDDTYAQSA 139
            ||.:...|.|                     |:.:.|         ||.|:::.|:..:..|::|
E. coli    93 GGVIDDLIVYYFTEDFFRLVVNSATREKDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAA 157

  Fly   140 T------RVSVGGLCQQFSLPENIQMSLFAADFLRSARKHFGEEVPLQFTPHGH-LMLAGEEHAE 197
            |      |.:|.|:...|.:.        |.|...:...:.||.        |: :.|..|:.|:
E. coli   158 TLFNDAQRQAVEGMKPFFGVQ--------AGDLFIATTGYTGEA--------GYEIALPNEKAAD 206

  Fly   198 ---SLKRSSQLQNELGARNELLTADRLTARFPWLNTKGIALGCLGLEKEGWFNPLALLSNFRRSA 259
               :|..:......||||:.|    ||.|          .:...|.|.:...:|||....:.   
E. coli   207 FWRALVEAGVKPCGLGARDTL----RLEA----------GMNLYGQEMDETISPLAANMGWT--- 254

  Fly   260 SGYGAHFISGQVVDFEFKSQTDISVVTDLGSNEGAYTGL---EKAVI--QLP------DGTRRTC 313
                   |:.:..|.:|..:..:.|..:.|:.:  ..||   ||.|:  :||      .|.:.. 
E. coli   255 -------IAWEPADRDFIGREALEVQREHGTEK--LVGLVMTEKGVLRNELPVRFTDAQGNQHE- 309

  Fly   314 KFALCVISAGASSEQIA---RLARIGVGPG---ILRV---PLPINARK 352
                .:|::|..|..:.   .|||:..|.|   |:::   .:|:...|
E. coli   310 ----GIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 60/300 (20%)
gcvTNP_417381.1 gcvT 1..362 CDD:234742 75/373 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.