DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and AT5G48440

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_199655.3 Gene:AT5G48440 / 834899 AraportID:AT5G48440 Length:459 Species:Arabidopsis thaliana


Alignment Length:470 Identity:95/470 - (20%)
Similarity:167/470 - (35%) Gaps:140/470 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DVLIIGGGGVGSSIAYWLKEKARDGLNVVVVEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFA 163
            ||:::|||.:|.:||  .:......|:|.||:| ......||....|.:......|.:....|  
plant    46 DVVVVGGGIIGLTIA--RQFLTGSDLSVAVVDK-AVPCSGATGAGQGYIWMTHKKPGSDVWDL-- 105

  Fly   164 ADFLRSARKH--------------FGEEVPLQFTPHGHLMLA-GEEHAESLKRSSQLQNELGARN 213
                 :.|.|              ...|..|.:...|.|::. ..|...:||:.....:|.|.|.
plant   106 -----TLRSHELWHKLAESLTDDGLDPEELLGWKKTGSLLIGRTTEECVALKQKVHELSEAGLRT 165

  Fly   214 ELLTADRLTARFPWL----NTKGIALGCLGLEKEGWFN---PLALLSNFRR--SASGYGAHFISG 269
            |.|::..|..:.|.:    ||     |...|..:...:   .:|.:....|  :.:|..|.|.:.
plant   166 EYLSSAELLLKEPAILVNDNT-----GAAFLPDDSQLDAHRAVAYIEKGNRAFATAGRYAEFYNE 225

  Fly   270 QVVDFEFKSQTDISVVTDLGSNEGAYTGLEKAVIQLPDGTRRTCKFALCVISAGASSEQIARLAR 334
            .|... .:|..|..||..:.:.:....| :||.|                ::||..|..:..   
plant   226 PVTGL-IRSDGDSKVVAGVKTLKRNLYG-KKATI----------------VAAGCWSGSLMH--- 269

  Fly   335 IGVGPGILR---VPL--PINARKRYMYAI------------------NSQAQSAPGM-------- 368
                 .:|:   :||  |:..||.::..:                  |.|:.|..|:        
plant   270 -----ELLKDCNIPLDVPVKPRKGHLLVVENFDSFHLNHGIMEAGYSNHQSASVSGLDVDERMLS 329

  Fly   369 -NMPMTIDPSG--------IFIRRDGLGGNYI--CVQDSTEEYNSAM--IDPQYFAQH------I 414
             :|..|:|.||        .|:..|.....:|  |:.:...|:...:  |..:.|.::      :
plant   330 ISMTATMDTSGNLVLGSSREFVGFDTEADEFIIRCIWERAAEFFPKLRDISLEDFIRNRKVRVGL 394

  Fly   415 RPHLYNRIPVLGEAQVVDSWAGCYDHNVYDENGILGAHPYYNNLYLATGFSGHGVQQSLAVGRAI 479
            ||::.:..||:|..                        |...|:|||.|..|.|:..:||....:
plant   395 RPYMPDGKPVIGSV------------------------PGLQNMYLAAGHEGGGLSMALATAEMV 435

  Fly   480 SELIMDGQFRTIDLS 494
            ::::: |:...:|.|
plant   436 TDMVL-GKPSQVDTS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 88/456 (19%)
AT5G48440NP_199655.3 DAO 52..438 CDD:279590 89/450 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003481
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.