DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and PDPR

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001309046.1 Gene:PDPR / 55066 HGNCID:30264 Length:879 Species:Homo sapiens


Alignment Length:469 Identity:95/469 - (20%)
Similarity:176/469 - (37%) Gaps:119/469 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ETEKVPIPTQSQFHFSGERDKSKEATVPDDFQTHCDVLIIGGGGVGSSIAYWLKEKARDGLNVVV 128
            |...:.:|||:|                        |:|.|||..|:|:||.|   ::.|...:|
Human    33 EARSMALPTQAQ------------------------VVICGGGITGTSVAYHL---SKMGWKDIV 70

  Fly   129 VEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFAADFLRSARKHFGEEVPLQ--FTPHGHLMLA 191
            :.:....|..:||...|.|    |...::.:....||:.........:|..:|  :|..|.:.||
Human    71 LLEQGRLAAGSTRFCAGIL----STARHLTIEQKMADYSNKLYYQLEQETGIQTGYTRTGSIFLA 131

  Fly   192 -GEEHAESLKRSSQLQNELGARNELLTADRLTARFPWLNTKGIALGCLGLEKEGWFN----PLAL 251
             .::...||||.:...|.:|..:|:::..::......||...: :|.:.:.::...:    .|||
Human   132 QTQDRLISLKRINAGLNVIGIPSEIISPKKVAELHHLLNVHDL-VGAMHVPEDAVVSSADVALAL 195

  Fly   252 LSNFRRSASGYGAHFISGQVVDFEFKSQTDISVVTDLGSNEGAYTGLEKAVIQLPDGTRRTCK-F 315
            .|    :||..|....             |.:.|..:...:|..||:|      .|..:..|: |
Human   196 AS----AASQNGVQIY-------------DRTSVLHVMVKKGQVTGVE------TDKGQIECQYF 237

  Fly   316 ALC----VISAGASSEQIARLARIGVGPGILRVPLPINARKRYMYAINSQAQSAPGMNMPMTIDP 376
            ..|    ....|.|:|:              .|.:|::|.:.: |.:....::....:.|..:|.
Human   238 VNCAGQWAYELGLSNEE--------------PVSIPLHACEHF-YLLTRPLETPLQSSTPTIVDA 287

  Fly   377 SG-IFIR--RDGL---------------GGNYICVQDSTEEYNSAMIDPQYFAQHIRP---HLYN 420
            .| |:||  :.|:               |.|.:.:|:..|:::           |..|   .|..
Human   288 DGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWD-----------HFEPLLSSLLR 341

  Fly   421 RIPVLGEAQVVDSWAGCYDHNVYDENGILGAHPYYNNLYLATGFSGHGVQQSLAVGRAISELIMD 485
            |:|.|...::: ....|.:....|...|:|..|.....::..|.:..|:......|:.::|.::.
Human   342 RMPELETLEIM-KLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLAEWMVH 405

  Fly   486 G----QFRTIDLSR 495
            |    ....:||.|
Human   406 GYPSENVWELDLKR 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 83/420 (20%)
PDPRNP_001309046.1 NADB_Rossmann 5..>74 CDD:304358 17/67 (25%)
DadA 39..426 CDD:223737 94/463 (20%)
FAO_M 405..460 CDD:292961 4/15 (27%)
GcvT 453..830 CDD:223481
GCV_T 463..736 CDD:279857
GCV_T_C 748..852 CDD:285832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.