DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and L2HGDH

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001286076.1 Gene:L2HGDH / 35156 FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster


Alignment Length:460 Identity:91/460 - (19%)
Similarity:159/460 - (34%) Gaps:142/460 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DVLIIGGGGVGSSIAYWLKEKARD------GLNVVVVEKDDTYAQSATRVSVG----GLCQQFSL 153
            |::::|||.||::       .||:      .|.|.|:||:...|:..:..:.|    |:   :..
  Fly    44 DLVVVGGGIVGAA-------SAREIVLRHPSLKVAVLEKECKLAKHQSGHNSGVIHAGI---YYK 98

  Fly   154 PENIQMSLFAADFLRSARKHFGE-EVPLQFTPHGHLMLAGEEHAESLKRSSQLQNELGARN---- 213
            |..::..| ..:.:..|..:..| ::|.:.|  |.|::|.:|  :.:|....|:....|.|    
  Fly    99 PGTLKARL-CVEGMHLAYAYLDEKKIPYKKT--GKLIVATDE--KEVKLLKDLEKRGIANNVPDL 158

  Fly   214 ELLTADRLTARFPWLNTKGIALGCLGLEKEGWFNPLALLSNFRRSASGYGAHF--ISGQV-VDF- 274
            .::....:....|:..      |.:.|.     :|...:.::......||..|  ..|.: :|| 
  Fly   159 RMIEGSEIQEIEPYCQ------GVMALH-----SPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFN 212

  Fly   275 -----EFKSQTDISVVTDLGSNEGAYTGLEKAVIQLPDGTRRTCKFALCVISAGASSEQIARLAR 334
                 |.|..||..|..     .||          .|..|.||.....|   .|..|:.:|... 
  Fly   213 VSKFTETKEGTDYPVTI-----HGA----------KPGQTVRTKNVLTC---GGLQSDLLAEKT- 258

  Fly   335 IGVGPGILRVPLPINARKRYMYAINSQAQSAPGMNMPMTIDPSGIFI------RRDG---LGGNY 390
                 |..|.|..:..|..|:.....:.....|...|:. ||...|:      |.||   ||.|.
  Fly   259 -----GCPRDPRIVPFRGEYLLLTKEKQHMVKGNIYPVP-DPRFPFLGVHFTPRMDGSIWLGPNA 317

  Fly   391 ICVQDSTEEYNSAMIDPQYFAQHIRPHLYNRIPVLGEAQVVDSWAGCYDHNVYDENGILGAHPYY 455
            :... ..|.|                                :|.   |.|:::   :..|..|.
  Fly   318 VLAL-KREGY--------------------------------TWG---DINLFE---LFDALRYP 343

  Fly   456 NNLYLATGFSGHGVQQ-------SLAVGRAISELIMDGQFRTIDLSR---------LSFDRLIVD 504
            ..:.:|:.:.|.|:.:       :|.: :|:.:.|.|  ....|:.|         :..|..:||
  Fly   344 GFVKMASKYIGFGLSEMSKSWFINLQI-KALQKYIPD--ITEYDIQRGPAGVRAQAMDLDGNLVD 405

  Fly   505 QPMFE 509
            ..:|:
  Fly   406 DFVFD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 82/436 (19%)
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 85/448 (19%)
NADB_Rossmann 69..440 CDD:304358 82/428 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.