DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and CG15309

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster


Alignment Length:104 Identity:22/104 - (21%)
Similarity:33/104 - (31%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LPDGTRRTCKFALCVISAGASSEQIARLARIGVGPGILRVPLPINARKRYMYAINSQAQSAPGMN 369
            || .|.||.....|.....:..|.|::..:...||.               |..||....|.|..
  Fly     9 LP-STNRTYSCVHCRAHLASHDELISKSFQGSQGPA---------------YLFNSVVNVACGQT 57

  Fly   370 MPMTIDPSGIFIRRD--------GLGGNYICVQDSTEEY 400
            ....: .:|:....|        .||..|....:|:::|
  Fly    58 EERVL-LTGLHAVADIYCECCKTPLGWKYEHAYESSQKY 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 22/104 (21%)
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.