DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and Pipox

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001012009.1 Gene:Pipox / 303272 RGDID:1311347 Length:390 Species:Rattus norvegicus


Alignment Length:446 Identity:104/446 - (23%)
Similarity:164/446 - (36%) Gaps:115/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DVLIIGGGGVGSSIAYWLKEKARDGLNVVVVEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFA 163
            |.::||.|..|...||.|                   ||::.:|.   |.:||.||.:...|...
  Rat     9 DAIVIGAGVQGCFTAYHL-------------------AQNSKKVL---LLEQFLLPHSRGSSHGQ 51

  Fly   164 ADFLRSAR----------------KHFGEEVPLQFTPHGHLMLAGEEHAESLKRSSQLQNELGAR 212
            :..:|.|.                .....|...|......|:..|.:....||......:..|..
  Rat    52 SRIIRKAYPEDFYTRMMDECYRTWAQLEREAGAQLHRRTELLFLGMKENPGLKTIQATLSRQGID 116

  Fly   213 NELLTADRLTARFPWLN-TKG-IALGCLGLEKEGWFNPLALLSNFRRSASGYGAHFISGQVVD-- 273
            :|.|::..|..|||.:. ||| :.|    |:|.|.    .|.::....|..:....:.|.|.|  
  Rat   117 HECLSSVHLKQRFPNIRFTKGEVGL----LDKTGG----VLYADKALRALQHVIRQLGGMVCDGE 173

  Fly   274 --FEFKSQTDISVVTDLGSNE--------GAYTG--LEKAVIQLPDGTRR--TCKFALCVISAGA 324
              .|.:....::|.|.|.|.:        |.:|.  |....|:||..|.|  .|.:...|..:.:
  Rat   174 KVVEIRPGLPVTVKTTLKSYQANSLVITAGPWTNRILRPLGIELPLQTLRINVCYWREKVPGSYS 238

  Fly   325 SSEQIARLARIGVGPGILRVPLPINARKRYMYAINSQAQSAPGMNMPM------TIDPSGIFIRR 383
            .|:....:..:.:.|             .::|.:  .|...||: |.:      ::||.    .|
  Rat   239 VSQAFPCILSLDLAP-------------HHIYGL--PASEYPGL-MKVCYHHGDSVDPE----ER 283

  Fly   384 DGLGGNYICVQDSTEEYNSAMIDPQYFAQHIRPHLYNRIPVLGEAQVVDSWAGCYDHNVYDENGI 448
            |       |.:..::     :.|.|.....::.||....|   |..:::.   |...|..||:.|
  Rat   284 D-------CPKTFSD-----IQDVQILCHFVKDHLPGLRP---EPDIMER---CMYTNTPDEHFI 330

  Fly   449 LGAHPYYNNLYLATGFSGHGVQQSLAVGRAISELIMD-------GQFRTIDLSRLS 497
            |..||.|:|:.:..||||||.:.:.|||:.:.||.|.       ..||....|:||
  Rat   331 LDCHPKYDNIVIGAGFSGHGFKLAPAVGKVLYELSMKLPPSYDLAPFRISRFSKLS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 99/432 (23%)
PipoxNP_001012009.1 soxA_mon 8..388 CDD:130444 104/446 (23%)
NADB_Rossmann 8..>68 CDD:304358 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D752680at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.