DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and fap2

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_593171.1 Gene:fap2 / 2541766 PomBaseID:SPAC139.04c Length:433 Species:Schizosaccharomyces pombe


Alignment Length:438 Identity:87/438 - (19%)
Similarity:168/438 - (38%) Gaps:90/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 VLIIGGGGVGSSIAYWL-KEKARDGLNVVVVEKDDTYAQSATRVSVGGLCQ-QFSLPENIQMSLF 162
            ::|:|.|..|.|.|..| |..:.|  |::.::.:...:..:....:..:.: :::..:.::::|.
pombe     5 IVIVGCGVFGLSTAVELAKNHSFD--NIIAIDAEPVPSSMSAANDINKIVRPEYADLKYMKLALE 67

  Fly   163 AADFLRSARKHFGEEVPLQFTPHGHLMLAGEE-----HAESLKRSSQLQNELG--ARNELLTADR 220
            |.:..|:     ..|:...:...|.|....::     ..|..:|:  |:..||  |...|.:::.
pombe    68 AMEKWRN-----DPELSSVYFECGRLSTISKDPYRARFDEVAQRN--LRKLLGDSALINLSSSEE 125

  Fly   221 LTARFPWLNTKG---IALGCLGLEKEGWFNPLALLSNFRRSASGYGAHFISGQVVDFE----FKS 278
            :..::|.|.:..   ..:..:..|..|:.|..|.|......|...|..|:.|:...|:    ..|
pombe   126 IRKKYPSLFSNSPLRSDMQAVVNEHAGYANSAASLKLLELKARELGVEFVFGKAGKFKKFVVNHS 190

  Fly   279 QTDISVVTDLGSNEGAYTGLEKAVIQLPDGTRRTCKFALCVISA------GASSEQIARLARIGV 337
            :|||    |...|.        ..:|..|||.......|..:.|      ..|....|:      
pombe   191 ETDI----DKNDNH--------VSVQTEDGTIYHADTILLAVGAYLNAYLNTSHRVCAK------ 237

  Fly   338 GPGILRVPLPINARKRYMYAINSQAQSAPGMNMPMTIDPSGIF----------IRRDGLGGNYIC 392
            |..:..:.|.....|.|             .|||:..||...:          |:....|..|:|
pombe   238 GLPVAHIQLTDEEFKTY-------------KNMPIIFDPDCAYAFPPYPVTKLIKLASTGYEYVC 289

  Fly   393 VQDSTEEYNSAMID-----------PQYFAQHIRPHLYNRIPVLGEAQVVDSWAGCYDHNVYDEN 446
            ..::..:.||.::.           |:|....:|..|...:|.|.:..:::: ..|:..:..|.|
pombe   290 NVETDYDENSKVVSIPHSGPSKSSLPKYAIIQMRRFLDTFLPDLADRSLINT-KMCWISDTEDAN 353

  Fly   447 GILGAHPYYNNLYLATGFSGHGVQQSLAVGRAISELIMDGQFRTIDLS 494
            .::...|.::|:::|.|.|||..:....:||.|::.|:.      |||
pombe   354 FLIDKVPQFDNVFVANGDSGHAFKFLPNIGRYIAQRILG------DLS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 82/425 (19%)
fap2NP_593171.1 DadA 1..405 CDD:223737 87/438 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3592
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.