DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and Ypel4

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001005342.1 Gene:Ypel4 / 241525 MGIID:3605071 Length:127 Species:Mus musculus


Alignment Length:38 Identity:9/38 - (23%)
Similarity:16/38 - (42%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 YICVQDSTE-EYNSAMIDPQYFAQHIRPHLYNRIPVLG 426
            |.||..... ..:..:|...:...|.|.:|:|.:..:|
Mouse    29 YSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVG 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 9/38 (24%)
Ypel4NP_001005342.1 RLR_C_like 28..118 CDD:416942 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.