DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and gcst-1

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_504502.1 Gene:gcst-1 / 178960 WormBaseID:WBGene00017765 Length:402 Species:Caenorhabditis elegans


Alignment Length:194 Identity:43/194 - (22%)
Similarity:64/194 - (32%) Gaps:57/194 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DGLNVVV--------VEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFAAD------------- 165
            ||:.:.|        ||:  ..|..|..|.:.||..:.:|.....:.|:.:|             
 Worm   223 DGVEISVDPTKAEQLVER--LLASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLA 285

  Fly   166 FLRSARKHFGEEVPLQFTPHGHLMLAGEEH-AESLKRSSQLQNELG--------ARNELLTADRL 221
            |:.:.|:....:.|            |.|| .:.||..|..:..:|        .|:.|...|.|
 Worm   286 FVVAKRRRETLDFP------------GAEHIVKQLKEKSWPKRRVGLLAPAGRCPRSHLPLIDPL 338

  Fly   222 TARFPWLNTKGIALGCLGLEKEGWFNPLALLSNFRRSASGYGAHFISGQVVDFEFKSQTDISVV 285
            ........|.|.....||..        ..::...:|.|..|..|    ||||..| |..:.||
 Worm   339 DKCSIGFVTSGCPSPTLGKN--------IAIAYVDKSHSKIGTKF----VVDFGAK-QAPVEVV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 43/194 (22%)
gcst-1NP_504502.1 PLN02319 2..399 CDD:177953 43/194 (22%)
GCV_T 34..287 CDD:279857 13/65 (20%)
GCV_T_C 297..391 CDD:285832 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.