powered by:
Protein Alignment l(2)37Bb and Ypel1
DIOPT Version :9
Sequence 1: | NP_536791.1 |
Gene: | l(2)37Bb / 49427 |
FlyBaseID: | FBgn0002021 |
Length: | 515 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006521738.1 |
Gene: | Ypel1 / 106369 |
MGIID: | 1913303 |
Length: | 217 |
Species: | Mus musculus |
Alignment Length: | 37 |
Identity: | 8/37 - (21%) |
Similarity: | 12/37 - (32%) |
Gaps: | 17/37 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 PLQFTPHGHLM-----------------LAGEEHAES 198
||:|....||: :.|:.|..|
Mouse 14 PLKFQDQAHLLWGTSPGPSELHWRSLAPVCGQHHTPS 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
l(2)37Bb | NP_536791.1 |
DadA |
113..501 |
CDD:223737 |
8/37 (22%) |
Ypel1 | XP_006521738.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167842026 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.