DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Bb and Ypel1

DIOPT Version :9

Sequence 1:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster
Sequence 2:XP_002727960.1 Gene:Ypel1 / 100360867 RGDID:2321291 Length:118 Species:Rattus norvegicus


Alignment Length:107 Identity:22/107 - (20%)
Similarity:37/107 - (34%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 YFAQHIRPHLYNRIPVLGEA------------QVVDSWAGCYDHNVYDENGILGAHP----YYNN 457
            |...|.|.||.|...::.::            .||:...|..:..|.    :.|.|.    |..|
  Rat    21 YSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVL----LTGLHAVADIYCEN 81

  Fly   458 LYLATGFSGHGVQQSLAVGRAISELIMDGQFRTIDLSRLSFD 499
            .....|:......:|       |:...:|:| .|:|:.:..|
  Rat    82 CKTTLGWKYEHAFES-------SQKYKEGKF-IIELAHMIKD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 22/107 (21%)
Ypel1XP_002727960.1 RLR_C_like 20..108 CDD:416942 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.