DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and RPS16A

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_013863.2 Gene:RPS16A / 855174 SGDID:S000004751 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:17/65 - (26%)
Similarity:27/65 - (41%) Gaps:16/65 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGR 138
            |:|:   ||:..|             |:.|:.|||........:..|..:....|:|.|:|.||:
Yeast    84 AIAK---GLVAYH-------------QKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGK 132

  Fly   139  138
            Yeast   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 13/56 (23%)
RPS16ANP_013863.2 PLN00210 3..143 CDD:177799 17/65 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.