powered by:
Protein Alignment mRpL4 and RPS16A
DIOPT Version :9
Sequence 1: | NP_524939.1 |
Gene: | mRpL4 / 49425 |
FlyBaseID: | FBgn0001995 |
Length: | 296 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013863.2 |
Gene: | RPS16A / 855174 |
SGDID: | S000004751 |
Length: | 143 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 65 |
Identity: | 17/65 - (26%) |
Similarity: | 27/65 - (41%) |
Gaps: | 16/65 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 AVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGR 138
|:|: ||:..| |:.|:.|||........:..|..:....|:|.|:|.||:
Yeast 84 AIAK---GLVAYH-------------QKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGK 132
Fly 139 138
Yeast 133 132
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0088 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.