DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and Rpl4

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_077174.1 Gene:Rpl4 / 67891 MGIID:1915141 Length:419 Species:Mus musculus


Alignment Length:266 Identity:61/266 - (22%)
Similarity:100/266 - (37%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PDVFAAQPRVDI---IQENVEWQSKYRYV--SMAHTKTRAEVRGGGR--KPWPQ-KGGGRARHG- 142
            |.||.|..|.||   :..|:...::..|.  .:|..:|.||..|.||  ...|: :|||..|.| 
Mouse    25 PAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 89

  Fly   143 SLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRV------LGLTSTLSVK----LAQDDLHIIDNV- 196
            .....|.:||.:.    :||..:..  :::||      ..:.|.|:..    |.....|.|:.| 
Mouse    90 GAFGNMCRGGRMF----APTKTWRR--WHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVP 148

  Fly   197 DIP------------TGDA-EFLKDLIAERNW----------------------------GPSVL 220
            ::|            |.:| :.||.|.|   |                            ||.: 
Mouse   149 ELPLVVEDKVEGYKKTKEAVQLLKKLKA---WNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCI- 209

  Fly   221 IVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHDTL----VLTVAAVKHLEQRLLYQLNR 281
            |.:||:    .|.:|..::..:.|:....||:..:.....:    :.|.:|.:.|::  ||...|
Mouse   210 IYNEDN----GIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDE--LYGTWR 268

  Fly   282 NDAASK 287
            ..|:.|
Mouse   269 KAASLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 56/251 (22%)
Rpl4NP_077174.1 PTZ00428 2..352 CDD:185611 61/266 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.