DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and Mrpl4

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001344828.1 Gene:Mrpl4 / 66163 MGIID:2137210 Length:300 Species:Mus musculus


Alignment Length:245 Identity:107/245 - (43%)
Similarity:144/245 - (58%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LPVSRNTARQAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRA 121
            :||.|... |||:|:.....:.::||.||||||||..||:||:.:...||..:|.:|.|:|||||
Mouse    55 IPVHRRPV-QAWVESLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRA 118

  Fly   122 EVRGGGRKPWPQKGGGRARHGS---------LRS----------PMLKGGGVVHGPRSPTTHFYM 167
            |:.             ...|.:         |||          ..:..|||.||||.||:::||
Mouse   119 ELL-------------NITHSNTLCQPSSKFLRSQTSGDTNTSYATVPAGGVAHGPRGPTSYYYM 170

  Fly   168 LPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGDAEFLKDLIAERNWGPSVLIVDEDH-MFPAN 231
            ||...|.|||...|:|||.||||||:|::::||.|.::|.:|...|:||.|||:||..| ..|.|
Mouse   171 LPMKVRALGLKVALTVKLMQDDLHIVDSLELPTADPQYLTELAQYRHWGSSVLLVDLTHEEMPKN 235

  Fly   232 ICQASDDLGYVNLMPTFGLNVYSMLKHDTLVLTVAAVKHLEQRLLYQLNR 281
            :..|:..|...||:|..||||||||||.|||||:.:|..||.:||:|.:|
Mouse   236 VVAATSGLNSFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKLLWQDSR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 94/210 (45%)
Mrpl4NP_001344828.1 Ribosomal_L4 81..278 CDD:306944 94/209 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848448
Domainoid 1 1.000 235 1.000 Domainoid score I2360
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32286
Inparanoid 1 1.050 260 1.000 Inparanoid score I3107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52318
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003002
OrthoInspector 1 1.000 - - oto93425
orthoMCL 1 0.900 - - OOG6_101056
Panther 1 1.100 - - LDO PTHR10746
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1141
SonicParanoid 1 1.000 - - X3343
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.