DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and Rpl4

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_071955.1 Gene:Rpl4 / 64302 RGDID:619824 Length:421 Species:Rattus norvegicus


Alignment Length:266 Identity:60/266 - (22%)
Similarity:100/266 - (37%) Gaps:81/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PDVFAAQPRVDI---IQENVEWQSKYRYV--SMAHTKTRAEVRGGGR--KPWPQ-KGGGRARHG- 142
            |.||.|..|.||   :..|:...::..|.  .:|..:|.||..|.||  ...|: :|||..|.| 
  Rat    25 PAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ 89

  Fly   143 SLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRV------LGLTSTLSVK----LAQDDLHIIDNV- 196
            .....|.:||.:.    :||..:..  :::||      ..:.|.|:..    |.....|.::.| 
  Rat    90 GAFGNMCRGGRMF----APTKTWRR--WHRRVNTTQKRYAICSALAASALPALVMSKGHCVEEVP 148

  Fly   197 DIP------------TGDA-EFLKDLIAERNW----------------------------GPSVL 220
            ::|            |.:| :.||.|.|   |                            ||.: 
  Rat   149 ELPLVVEDKVESYKKTKEAVQLLKKLKA---WNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCI- 209

  Fly   221 IVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHDTL----VLTVAAVKHLEQRLLYQLNR 281
            |.:||:    .|.:|..::..:.|:....||:..:.....:    :.|.:|.:.|::  ||...|
  Rat   210 IYNEDN----GIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDE--LYGTWR 268

  Fly   282 NDAASK 287
            ..|:.|
  Rat   269 KAASLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 55/251 (22%)
Rpl4NP_071955.1 PTZ00428 2..350 CDD:185611 60/266 (23%)
Ribosomal_L4 10..265 CDD:294231 56/255 (22%)
Ribos_L4_asso_C 275..348 CDD:291072 60/266 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.