DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and rpl-4

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_491416.1 Gene:rpl-4 / 172074 WormBaseID:WBGene00004415 Length:345 Species:Caenorhabditis elegans


Alignment Length:296 Identity:59/296 - (19%)
Similarity:98/296 - (33%) Gaps:125/296 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 AAQPRVDIIQENVE-WQSKYRYVSMAHTKTRAEV--------------------RGGGRKPWPQK 134
            ||:|.|.:..|..| .||:.|..::..|..|.::                    :.|.:......
 Worm     2 AARPLVTVYDEKYEATQSQIRLPAVFRTPIRPDLVSFIADQVRRNRRQAHAVNTKAGKQHSAESW 66

  Fly   135 GGGRARHGSLRSPMLKGGGVVHGPRSPTTH----------------FYMLPFYKR---------- 173
            |.|||   ..|.|.::|||         ||                |..|..::|          
 Worm    67 GTGRA---VARIPRVRGGG---------THRSGQGAFGNMCRGGHMFAPLKVFRRWHRNVNIAQK 119

  Fly   174 VLGLTSTLSVK----LAQDDLHIIDNV-DIP--TGD---------------------AEFLKDLI 210
            ...::|.::..    |.|...|:||.| ::|  ..|                     |:..|...
 Worm   120 RYAVSSAIAASGIPALLQARGHVIDQVAEVPLVVSDKVESFRKTKEAVVFLRRSHLWADIEKVYN 184

  Fly   211 AERN---------------WGPSVLIVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHDT 260
            ::||               .|| |:|..:|    |...:|..::..|::|....||         
 Worm   185 SKRNRAGKGKLRNRQHKQKLGP-VVIYGQD----AECARAFRNIPGVDVMNVERLN--------- 235

  Fly   261 LVLTVAAVKHLEQRLLYQLNRNDAASKGGKFKLDQV 296
             :|.:|...||.:.:::    .::|.|    |||.:
 Worm   236 -LLKLAPGGHLGRLIIW----TESAFK----KLDTI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 54/272 (20%)
rpl-4NP_491416.1 PTZ00428 1..345 CDD:185611 59/296 (20%)
Ribosomal_L4 7..264 CDD:294231 56/291 (19%)
Ribos_L4_asso_C 275..345 CDD:291072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.