DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL4 and Rps16

DIOPT Version :9

Sequence 1:NP_524939.1 Gene:mRpL4 / 49425 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006228674.1 Gene:Rps16 / 140655 RGDID:621031 Length:150 Species:Rattus norvegicus


Alignment Length:119 Identity:37/119 - (31%)
Similarity:49/119 - (41%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AVA--ERKVGLIELH-PDVFAAQPRVDIIQ----ENVEWQSKYRYVSMAHTKTRAEVRGGGRKPW 131
            |||  :|..|||::: ..:...:||.  :|    |.|....|.|:   |....|..|:|||..  
  Rat    21 AVAHCKRGNGLIKVNGRPLEMIEPRT--LQYKLLEPVLLLGKERF---AGVDIRVRVKGGGHV-- 78

  Fly   132 PQKGGGRARHGSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKL 185
            .|..|.....|.....:||.|.|          |..| |...||.|:.:||.||
  Rat    79 AQIYGECEDLGVSVRQLLKQGWV----------FTKL-FGHCVLQLSGSLSQKL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 31/108 (29%)
Rps16XP_006228674.1 Ribosomal_S9 6..>102 CDD:294239 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.