DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIAPIN1 and DRE2

DIOPT Version :9

Sequence 1:NP_524938.1 Gene:CIAPIN1 / 49424 FlyBaseID:FBgn0001977 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_012997.3 Gene:DRE2 / 853945 SGDID:S000001779 Length:348 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:84/273 - (30%)
Similarity:131/273 - (47%) Gaps:58/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MENFKGLQKSLYIW--TDSADLDKRVE-QLKAATGGDVALENVHRL-SFSSYANSSFDLIVIECA 61
            :..|:.:.:..|.|  .||:.|::.|. .||.....:..|::..:| :|...::|:.:|      
Yeast   104 INGFEIINEPDYCWIKMDSSKLNQTVSIPLKKKKTNNTKLQSGSKLPTFKKASSSTSNL------ 162

  Fly    62 QLTDSYVKLLHMLKPSGKLHLVSYIGPAASLLQEIKLSGFI-NCREDSPDALTAEKPGYETGSSA 125
               .|:.|..|..:|..| ...|:..|:..:..|.|:...: :..|||.|      ..:.:.||.
Yeast   163 ---PSFKKADHSRQPIVK-ETDSFKPPSFKMTTEPKVYRVVDDLIEDSDD------DDFSSDSSK 217

  Fly   126 RLSFAKKNASAVNVWKISGDDEELIDEEELLDEEDKQKPDPAGLRVC--STTGKRKACKNCSCGL 188
            ...|.:.:.|         ||.  |:||||:||:...| ....:..|  |.|.|:||||:|:||:
Yeast   218 AQYFDQVDTS---------DDS--IEEEELIDEDGSGK-SMITMITCGKSKTKKKKACKDCTCGM 270

  Fly   189 AEELETE------KQSQ--KATENAKS------------SCGNCYLGDAFRCSTCPYLGMPAFKP 233
            .|:.|.|      :|.:  |.||:..:            .||:|.||||||||.|||||:|||||
Yeast   271 KEQEENEINDIRSQQDKVVKFTEDELTEIDFTIDGKKVGGCGSCSLGDAFRCSGCPYLGLPAFKP 335

  Fly   234 GEKVQL---ADNL 243
            |:.:.|   :|:|
Yeast   336 GQPINLDSISDDL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIAPIN1NP_524938.1 CIAPIN1 172..239 CDD:282890 40/88 (45%)
DRE2NP_012997.3 COG5636 56..348 CDD:227923 83/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004602
OrthoInspector 1 1.000 - - oto98939
orthoMCL 1 0.900 - - OOG6_102453
Panther 1 1.100 - - LDO PTHR13273
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R350
SonicParanoid 1 1.000 - - X3221
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.