DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIAPIN1 and SPBC337.10c

DIOPT Version :9

Sequence 1:NP_524938.1 Gene:CIAPIN1 / 49424 FlyBaseID:FBgn0001977 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_595411.1 Gene:SPBC337.10c / 2540921 PomBaseID:SPBC337.10c Length:288 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:81/210 - (38%)
Similarity:100/210 - (47%) Gaps:57/210 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 PSGKLHLVSYIGPA-ASLLQEIKLSGFINCREDSPDALT------------AEKPGYETGSSARL 127
            |.|.|.:.|....| .|......|||:: ....||..|:            :.|.|.....:..|
pombe    82 PGGTLRVYSTADEADESFEMTALLSGWL-IESKSPWILSRPNQVEAVPIKLSNKNGQSASKNKIL 145

  Fly   128 SFAKKNASAVNVWKISG-DDEELIDEEELLDEE--------DKQKPDPAGLRVCSTTGKRK-ACK 182
            .|.|.:...:    ||| ||:|||||:|||||.        .:.||:|         ||:| |||
pombe   146 DFLKSDKENL----ISGDDDQELIDEDELLDESAHDNVLKVPECKPEP---------GKKKRACK 197

  Fly   183 NCSCGLAEELETEKQSQKA--------------------TENAKSSCGNCYLGDAFRCSTCPYLG 227
            ||:|||.|..|.|.....|                    ::||.|||||||||||||||.|||:|
pombe   198 NCTCGLREMEEHESSKTSAQLEAVKLTDTTEVDFTEKLKSKNAVSSCGNCYLGDAFRCSGCPYIG 262

  Fly   228 MPAFKPGEKVQLADN 242
            ||||.||:.|.||:|
pombe   263 MPAFNPGDTVILAEN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIAPIN1NP_524938.1 CIAPIN1 172..239 CDD:282890 43/87 (49%)
SPBC337.10cNP_595411.1 COG5636 1..288 CDD:227923 81/210 (39%)
DRE2_N 3..131 CDD:293408 12/49 (24%)
CIAPIN1 178..274 CDD:282890 46/104 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I1590
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004602
OrthoInspector 1 1.000 - - oto100415
orthoMCL 1 0.900 - - OOG6_102453
Panther 1 1.100 - - LDO PTHR13273
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R350
SonicParanoid 1 1.000 - - X3221
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.