DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CIAPIN1 and T20B12.7

DIOPT Version :9

Sequence 1:NP_524938.1 Gene:CIAPIN1 / 49424 FlyBaseID:FBgn0001977 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_498632.1 Gene:T20B12.7 / 176051 WormBaseID:WBGene00020604 Length:238 Species:Caenorhabditis elegans


Alignment Length:222 Identity:78/222 - (35%)
Similarity:114/222 - (51%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEQLKAATGGDVALENVHRLSFSSYANSSFDLIVIECAQLTDSYVKLLHMLKPSGKLHLVSYIGP 88
            |...:...|.|..:.:|.|.....   ...:|:...|..:.|       ::|.:|:  ::.:...
 Worm    38 VSNARELRGADSLVGDVERAIIQV---QETELLAEVCNTVFD-------VMKQNGE--VIVFSQD 90

  Fly    89 AASLLQEIKLSGFINCREDSPDALTAEKPGYETGSSARLSFAKKNASAVNVWKISGDDEELIDEE 153
            ..:..::::::||         .:|.....:.......::|.:|.|..:.|..    ||:||||:
 Worm    91 LTTAQRKLRIAGF---------RVTEVAAEFPVRGIKLVNFGEKVALDLGVVA----DEDLIDED 142

  Fly   154 ELLDEEDKQKPDPAGLRV--C---STTGKRKACKNCSCGLAEELETEKQSQKATENAKSSCGNCY 213
            .||.|||.:||....|:.  |   ....|::|||||||||||:.|.||..|.|.| .|||||||.
 Worm   143 GLLQEEDFEKPTGDQLKAGGCGPDDPNKKKRACKNCSCGLAEQEELEKMGQIAAE-PKSSCGNCS 206

  Fly   214 LGDAFRCSTCPYLGMPAFKPGEKVQLA 240
            ||||||||||||||.|.|||||.|:::
 Worm   207 LGDAFRCSTCPYLGQPPFKPGETVKIS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CIAPIN1NP_524938.1 CIAPIN1 172..239 CDD:282890 47/69 (68%)
T20B12.7NP_498632.1 CIAPIN1 163..232 CDD:282890 47/69 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164552
Domainoid 1 1.000 68 1.000 Domainoid score I6411
eggNOG 1 0.900 - - E1_COG5636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004602
OrthoInspector 1 1.000 - - oto17817
orthoMCL 1 0.900 - - OOG6_102453
Panther 1 1.100 - - LDO PTHR13273
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R350
SonicParanoid 1 1.000 - - X3221
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.