DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERCA and CG45063

DIOPT Version :9

Sequence 1:NP_726381.1 Gene:SERCA / 49297 FlyBaseID:FBgn0263006 Length:1020 Species:Drosophila melanogaster
Sequence 2:NP_001286728.1 Gene:CG45063 / 19835490 FlyBaseID:FBgn0266433 Length:252 Species:Drosophila melanogaster


Alignment Length:172 Identity:46/172 - (26%)
Similarity:83/172 - (48%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RGLTLDQIKANQKKYGPN--ELPTEEGKSIWQLVLEQFDDLLVKILLLAAIISFVLALFEEHEET 84
            :|||.:.......:.|.|  .|||:.....| :.|:....:|..|:||::|.||.:......:..
  Fly    63 QGLTSEAAGRKLARNGKNVLPLPTKLELRPW-IFLKSCFSILGIIILLSSIASFAMYYLFATKTP 126

  Fly    85 FTAFVEPLVI---LLILIANAVVGV---WQERNAESAIEALKEYEPEMGKVVRQDKSGIQKVRAK 143
            ....|:|..:   :::|:...:.|:   .|..:.|..:.|..|..|....|:|..:..:  :|.:
  Fly   127 DNGKVDPEFLVAGIILLVTFFLAGLTVQMQGDDDEDMLIAFDELMPMYCTVIRDGEKEV--IRTQ 189

  Fly   144 EIVPGDLVEVSVGDKIPADIRITHIYSTT-LRIDQSILTGES 184
            ::||||.:.:..|.::|||:|   .:||| |.::...|||.|
  Fly   190 DLVPGDTLPIKYGQRLPADMR---FFSTTGLELNNVALTGHS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERCANP_726381.1 P-type_ATPase_SERCA 5..989 CDD:319778 46/172 (27%)
CG45063NP_001286728.1 Cation_ATPase_N 46..117 CDD:214842 17/54 (31%)
E1-E2_ATPase 140..>230 CDD:278548 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.