DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stx17 and Syx7

DIOPT Version :9

Sequence 1:XP_005158110.1 Gene:stx17 / 492808 ZFINID:ZDB-GENE-041114-164 Length:292 Species:Danio rerio
Sequence 2:NP_730632.1 Gene:Syx7 / 36173 FlyBaseID:FBgn0267849 Length:282 Species:Drosophila melanogaster


Alignment Length:276 Identity:56/276 - (20%)
Similarity:111/276 - (40%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


Zfish    15 EPPIQKFIKVAIPTDLERLHQHQHNIEKF--QRNRQWD------KLHHEHINSSRTVQQLRSNLR 71
            |...|:..:: |.|.::::.|:...:::.  |.|...|      :||.....:::.|....:.:.
  Fly    20 EIDFQRLAQI-IATSIQKVQQNVSTMQRMVNQLNTPQDSPELKKQLHQIMTYTNQLVTDTNNQIN 83

Zfish    72 EMEKLCGRVRSVDAEALEKLVQPIRDRASAAIQEF---------------LQIHSDAVN------ 115
            |::|...|...:..:.|.       |..:||:..|               .|...|:.|      
  Fly    84 EVDKCKERHLKIQRDRLV-------DEFTAALTAFQSVQRKTADIEKTALRQARGDSYNIARPPG 141

Zfish   116 ---RQNFNEAIATVAETSHSEDD--TGVSGSPVTQTQLLLPEIPSEQNAAESWD----SLAEDLL 171
               ..:.|.:.:.....|..||:  ...|.....|||:   |..::..|.|..:    .|..:::
  Fly   142 SSRTGSSNSSASQQDNNSFFEDNFFNRKSNQQQMQTQM---EEQADLQALEEQEQVIRELENNIV 203

Zfish   172 QLNGLVNEFSTIVHAQQEKIDSIEANVSIAAANVEEGTQSLGKAA-------RAKLAVLPVAGAV 229
            .:|.:..:...:|:.|...:||||:.|...:..|.:||::|.||:       :.||.::.:..||
  Fly   204 GVNEIYKKLGALVYEQGLTVDSIESQVEQTSIFVSQGTENLRKASSYRNKVRKKKLILVGILSAV 268

Zfish   230 VGGVLGGPLGLLAGFK 245
            :..::   |.|:..||
  Fly   269 LLAII---LILVFQFK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stx17XP_005158110.1 SNARE_syntaxin17 153..214 CDD:277199 15/64 (23%)
Syx7NP_730632.1 Syntaxin_2 30..126 CDD:291208 17/102 (17%)
COG5325 <97..276 CDD:227635 39/191 (20%)
SNARE 188..247 CDD:304603 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.