DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NUP98 and Neos

DIOPT Version :9

Sequence 1:NP_001352054.1 Gene:NUP98 / 4928 HGNCID:8068 Length:1831 Species:Homo sapiens
Sequence 2:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster


Alignment Length:242 Identity:48/242 - (19%)
Similarity:90/242 - (37%) Gaps:90/242 - (37%)


- Green bases have known domain annotations that are detailed below.


Human  1229 YQTPLELKLKHSTVHVDELCP----------------------LIVP------NLGVAVIHDYAD 1265
            |...:|.:||:|::.||.|.|                      |:.|      ::.|.:::.   
  Fly   143 YAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYG--- 204

Human  1266 WVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDS------------QLNEPREYIQILERRR 1318
             |.....::|....:       ||....:...|:.|:            |...|:|...:|||  
  Fly   205 -VPAEHRNMPLEDAI-------TLISTDFRLKKQRDAVVLPPSTSIHKGQRRHPQEMQGLLER-- 259

Human  1319 AFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKR-------ISEACSLAQ-QSGDHRLAL- 1374
                         :.:...||.  |..|.:..||.|:|       :.||.:||: ::.|..:.| 
  Fly   260 -------------LADNHPLTA--SQYEVILKYLEGEREEQLKREVGEANALAKLKAPDPEIELQ 309

Human  1375 --LLSQFVGSQSVRELLTMQLVDWHQLQADSF--IQDERLRIFALLA 1417
              :|| .:...:|.::.:       :|...:|  ::::| |:..|||
  Fly   310 KKILS-IMNKPAVTDVTS-------ELMYPTFEAVKEDR-RLMELLA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NUP98NP_001352054.1 Nucleoporin_FG 40..149 CDD:316182
Nucleoporin_FG 239..332 CDD:316182
Herpes_BLLF1 <243..666 CDD:330317
Nucleoporin_FG 363..463 CDD:316182
Nucleoporin2 723..862 CDD:309287
Nup96 1348..1637 CDD:314912 20/83 (24%)
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 1/5 (20%)
RRM_SF 20..78 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.