DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and PPG1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_014429.3 Gene:PPG1 / 855766 SGDID:S000005315 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:116/310 - (37%)
Similarity:189/310 - (60%) Gaps:21/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            |.:|..:.||.:.:        .|.|..:|.||.|.:|:.:.:..::.::.|:.:.||:|||::|
Yeast     1 MELDECLERLYKAQ--------LLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHD 57

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            :|.:|:.||..|::||||||||||||..|:|||.||:..|::|.....|||||||...|.:.|||
Yeast    58 MLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGF 122

  Fly   135 YDECKRRY--SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQG 197
            |.||..:|  :.::|:..||.|:.|.:..|:|::|||.||||||::.:::||:.|.|..::|..|
Yeast   123 YTECLNKYGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDG 187

  Fly   198 LLCDLLWSDPDKD---TMGWGEND--------RGVSFTFGAEVVAKFLQKHEFDLICRAHQVVED 251
            .:.||:||||:::   |:...:|.        ||..:|||..||.|||:.::.:.|.||||:..:
Yeast   188 AMADLVWSDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNE 252

  Fly   252 GYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301
            ||:.:...::.|::||||||....|..:::.:.......|.:.:.|.:.|
Yeast   253 GYQIYFDGLVTTVWSAPNYCYRCGNKASILELYSKDQFYFNVFEEAPENK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 113/302 (37%)
PPG1NP_014429.3 MPP_PP2A_PP4_PP6 2..299 CDD:277360 113/304 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.