DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and CNA1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:109/264 - (41%)
Similarity:159/264 - (60%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIK 111
            :|.||:|:||:.|||||||||||||:|||.||.|.|.:|||||||||||..|.|  ||:..|.:|
Yeast   104 EPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDYVDRGAFSFE--CLIYLYSLK 166

  Fly   112 YSE--NFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGL 174
            .:.  .|::|||||||..:...:.|.:|...:|.::::......||.||:||:::.:.||.|||:
Yeast   167 LNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNVLPLAALMNGQYFCVHGGI 231

  Fly   175 SPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDP--------DKDTMGWGEND------RGVSFTF 225
            ||:|.|:|.:.:|.|..::|.:||:|||||:||        |.......|::      ||.||.|
Yeast   232 SPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFDQSEDEFVPNSLRGCSFAF 296

  Fly   226 GAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKR------MLVTLFSAPNYCGEFDNAGAMMSVD 284
            ..:...|||:.:....|.|||:..:.||..:...      .|:|:||||||...:.|..|::..:
Yeast   297 TFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMFSAPNYLDTYHNKAAVLKYE 361

  Fly   285 DTLM 288
            :.:|
Yeast   362 ENVM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 109/264 (41%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 109/264 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.