DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and TOPP6

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_851123.1 Gene:TOPP6 / 834356 AraportID:AT5G43380 Length:331 Species:Arabidopsis thaliana


Alignment Length:300 Identity:228/300 - (76%)
Similarity:263/300 - (87%) Gaps:1/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 67
            |...::|:|:||||.| .:|||.|||||.||:.||..||:|||.||.|||||||:||||||||||
plant     2 DPGTLNSVINRLLEAR-EKPGKIVQLSETEIKQLCFVSRDIFLRQPNLLELEAPVKICGDIHGQY 65

  Fly    68 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIY 132
            .|||||||:||:||.|||||||||||||||||||||||||||||:.|||||||||||.|||||||
plant    66 PDLLRLFEHGGYPPNSNYLFLGDYVDRGKQSLETICLLLAYKIKFPENFFLLRGNHESASINRIY 130

  Fly   133 GFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQG 197
            |||||||||:|:|:|:.||||||||||||::||:|||.||||||:|.|:.|||.|.||||:||:|
plant   131 GFYDECKRRFSVKIWRIFTDCFNCLPVAALIDERIFCMHGGLSPELLSLRQIRDIRRPTDIPDRG 195

  Fly   198 LLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLV 262
            |||||||||||||..|||.||||||:|||:::|:.||::.:.|||||||||||||:||||.:.||
plant   196 LLCDLLWSDPDKDVRGWGPNDRGVSYTFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQLV 260

  Fly   263 TLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            |:|||||||||||||||||||.:.|.|||||||..||:.|
plant   261 TIFSAPNYCGEFDNAGAMMSVSEDLTCSFQILKSNDKKSK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 223/289 (77%)
TOPP6NP_851123.1 PTZ00480 6..297 CDD:185658 224/291 (77%)
MPP_PP1_PPKL 6..293 CDD:277359 222/287 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.