DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and PP5.2

DIOPT Version :10

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001031534.1 Gene:PP5.2 / 818881 AraportID:AT2G42810 Length:538 Species:Arabidopsis thaliana


Alignment Length:252 Identity:111/252 - (44%)
Similarity:160/252 - (63%) Gaps:7/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LCLKSREIFLSQPILLELEAP----LKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRG 95
            :.|::|:|.|:.|.|:::..|    :.:|||:|||:||||.:||..|.|.|.| |||.||:||||
plant   252 IVLQTRQILLALPSLVDISVPHGKHITVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRG 316

  Fly    96 KQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVA 160
            ..|:|.|..|.|:|.....:.:|.|||||..|:|:||||..|.:.:.|.|....|.:.|..||:|
plant   317 SFSVEIILTLFAFKCMCPSSIYLARGNHESKSMNKIYGFEGEVRSKLSEKFVDLFAEVFCYLPLA 381

  Fly   161 AIVDEKIFCCHGGL-SPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFT 224
            .:::.|:|..|||| |.|...:..||.|.|..:.|::||:|:|||||| :...|.|.:.|||..:
plant   382 HVINGKVFVVHGGLFSVDGVKLSDIRAIDRFCEPPEEGLMCELLWSDP-QPLPGRGPSKRGVGLS 445

  Fly   225 FGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMM 281
            ||.:|..:|||.:..||:.|:|:|.::|||......|:|:|||||||.:..|.||.:
plant   446 FGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKLITVFSAPNYCDQMGNKGAFI 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 111/252 (44%)
PP5.2NP_001031534.1 PLN03088 13..>155 CDD:215568
TPR repeat 13..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR repeat 81..109 CDD:276809
MPP_PP5_C 216..531 CDD:277362 111/252 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.