DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and TOPP4

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_181514.1 Gene:TOPP4 / 818571 AraportID:AT2G39840 Length:321 Species:Arabidopsis thaliana


Alignment Length:296 Identity:231/296 - (78%)
Similarity:260/296 - (87%) Gaps:0/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|.||.||.|||.|||||.|||||.||:.||..:|:|||.||.|||||||:||||||||||.|||
plant    19 LDDIIRRLTEVRLARPGKQVQLSEAEIKQLCTTARDIFLQQPNLLELEAPIKICGDIHGQYSDLL 83

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYD 136
            ||||||||||.:|||||||||||||||||||||||||||||..||||||||||||||||||||||
plant    84 RLFEYGGFPPSANYLFLGDYVDRGKQSLETICLLLAYKIKYPGNFFLLRGNHECASINRIYGFYD 148

  Fly   137 ECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCD 201
            |||||:::::||.||||||||||||::|:||.|.||||||||..:::||.:.|||.:||.|||||
plant   149 ECKRRFNVRVWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLDHLDEIRNLPRPTMIPDTGLLCD 213

  Fly   202 LLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFS 266
            ||||||.||..|||.||||||:|||.:.|::||.||:.||:|||||||||||||||.|.|||:||
plant   214 LLWSDPGKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQLVTVFS 278

  Fly   267 APNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            ||||||||||||||||||:.|||||||||||:|:.|
plant   279 APNYCGEFDNAGAMMSVDENLMCSFQILKPAEKKTK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 226/288 (78%)
TOPP4NP_181514.1 MPP_PP1_PPKL 18..308 CDD:277359 226/288 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100608
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm1134
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.