DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and mts

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster


Alignment Length:296 Identity:139/296 - (46%)
Similarity:197/296 - (66%) Gaps:10/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 70
            ::|..|.:|.|..        ||:|.::|.||.|::||...:..:.|::.|:.:|||:|||::||
  Fly     9 DLDQWIEQLNECN--------QLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65

  Fly    71 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFY 135
            :.||..||..|::||||:|||||||..|:||:.||:|.|::|.|...:||||||...|.::||||
  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130

  Fly   136 DECKRRY-SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            |||.|:| :..:||.|||.|:.||:.|:||.:|||.||||||.:.|::.||.:.|..:||.:|.:
  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            ||||||||| |..|||.:.||..:|||.::...|...:...|:.||||:|.:||.:...|.:||:
  Fly   196 CDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRNVVTI 259

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300
            |||||||....|..|:|.:||:|..||....||.:|
  Fly   260 FSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAPRR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 136/290 (47%)
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 137/292 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.