DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Pp4-19C

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:305 Identity:133/305 - (43%)
Similarity:201/305 - (65%) Gaps:14/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVMNIDSIISRL--LEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDI 63
            |.|..::|..|.:|  .|:          :.|.|::.||.|:|||.:.:..:..:::|:.:||||
  Fly     1 MSDYSDLDRQIEQLKRCEI----------IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDI 55

  Fly    64 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASI 128
            |||:|||..||:.||..||.||||:||:||||..|:||..||||.|::|.:...|:|||||...|
  Fly    56 HGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQI 120

  Fly   129 NRIYGFYDECKRRY-SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTD 192
            .::|||||||.|:| |..:|:..|:.|:.|.::||:|.||||.||||||.:..::|||.|.|..:
  Fly   121 TQVYGFYDECLRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQE 185

  Fly   193 VPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFA 257
            ||..|.:||||||||: |..|||.:.||..:.||::||::|.:.::.|:||||||:|.:|:::..
  Fly   186 VPHDGPMCDLLWSDPE-DQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHF 249

  Fly   258 KRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            ...::|::||||||....|..|::.:::.|...|.|.:.|.:..:
  Fly   250 NETVLTVWSAPNYCYRCGNVAAILELNEYLHRDFVIFEAAPQESR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 130/292 (45%)
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 130/294 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438830
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37653at7147
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.