DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and PpD5

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:292 Identity:190/292 - (65%)
Similarity:231/292 - (79%) Gaps:5/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRL--LEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :|.||.:|  :.|...|.|   .|||..|..:|..|||:|||||:||||.||:|||||:|||:.|
  Fly    25 LDVIIGQLKTMAVGNRRAG---NLSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKD 86

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            |||:|:..|.||.|||||||||||||..|:||:.|||.||::|.|.|||||||||.|.:||:|||
  Fly    87 LLRIFQQCGVPPLSNYLFLGDYVDRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGF 151

  Fly   135 YDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            :||||||||||||::|.||::|:|||||:.::|||.||||||||.:::.|||:.||||||..|||
  Fly   152 FDECKRRYSIKLWRSFVDCYDCMPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLL 216

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            |||||||||:.|..|..|||||||||||.:|..||.:|:|:||.||||||||||||||.|.|||:
  Fly   217 CDLLWSDPDETTGTWASNDRGVSFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTI 281

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKP 296
            |||||||..|||.||::.||..|:|.|.|::|
  Fly   282 FSAPNYCDIFDNCGAVLVVDAKLVCHFVIIRP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 189/290 (65%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 190/292 (65%)
MPP_superfamily 25..313 CDD:301300 189/290 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.