DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and CanA1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster


Alignment Length:260 Identity:103/260 - (39%)
Similarity:156/260 - (60%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSE 114
            ::::|||:.:|||||||::||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.|..
  Fly   118 MIDVEAPITVCGDIHGQFFDLVKLFEVGGPPATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPT 182

  Fly   115 NFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLT 179
            ...||||||||..:...:.|..||..:||..::....:.|:|||:||:::::..|.||||||::.
  Fly   183 TLSLLRGNHECRHLTEYFTFKQECIIKYSESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIF 247

  Fly   180 SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGEND-------RGVSFTFGAEVVAKFLQKH 237
            :::.|:.:.|..:.|..|.:||||||||.:|......|:       ||.|:.|......:||||:
  Fly   248 TLDDIKTLNRFREPPAYGPMCDLLWSDPLEDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKN 312

  Fly   238 EFDLICRAHQVVEDGYEFFAKRM------LVTLFSAPNYCGEFDNAGAMMSVDDTLM------CS 290
            ....|.|||:..:.||..:.|..      |:|:||||||...::|..|::..::.:|      ||
  Fly   313 NLLSIVRAHEAQDAGYRMYRKNQVTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 377

  Fly   291  290
              Fly   378  377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 103/260 (40%)
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 103/260 (40%)
PP2Ac 98..369 CDD:197547 100/250 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.