DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppp1ccb

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001357876.1 Gene:Ppp1ccb / 434233 MGIID:3647492 Length:337 Species:Mus musculus


Alignment Length:299 Identity:279/299 - (93%)
Similarity:289/299 - (96%) Gaps:0/299 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 67
            |.:||||||.|||||||::|||||||.|.||||||||||||||||||||||||||||||||||||
Mouse     5 DKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69

  Fly    68 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIY 132
            |||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||
Mouse    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 134

  Fly   133 GFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQG 197
            ||||||||||:|||||||||||||||:|||||||||||||||||||.||||||||||||||||||
Mouse   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199

  Fly   198 LLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLV 262
            |||||||||||||.:||||||||||||||||||||||.||:.||||||||||||||||||||.||
Mouse   200 LLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLV 264

  Fly   263 TLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301
            ||||||||||||||||||||||:||||||||||||:|:|
Mouse   265 TLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 273/289 (94%)
Ppp1ccbNP_001357876.1 MPP_PP1_PPKL 8..298 CDD:277359 273/289 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100608
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.