DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Pp1alpha-96A

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster


Alignment Length:301 Identity:291/301 - (96%)
Similarity:296/301 - (98%) Gaps:0/301 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHG 65
            |.|:||||||||||||||||||||||||||.|||.||||||||||||||||||||||||||||||
  Fly     1 MSDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHG 65

  Fly    66 QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130
            |||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||
  Fly    66 QYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINR 130

  Fly   131 IYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPD 195
            ||||||||||||:|||||||||||||||||||||||||||||||||||:||||||||||||||||
  Fly   131 IYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPD 195

  Fly   196 QGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRM 260
            |||||||||||||||||||||||||||||||||||.||||||||||||||||||||||||||||.
  Fly   196 QGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQ 260

  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301
            ||||||||||||||||||||||||||||||||||||||||:
  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 282/289 (98%)
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 282/289 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438740
Domainoid 1 1.000 356 1.000 Domainoid score I201
eggNOG 1 0.900 - - E1_COG0639
Homologene 1 1.000 - - H100608
Inparanoid 1 1.050 514 1.000 Inparanoid score I297
Isobase 1 0.950 - 0 Normalized mean entropy S19
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm6544
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
1312.750

Return to query results.
Submit another query.