DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and ppp1cbl

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:298 Identity:220/298 - (73%)
Similarity:239/298 - (80%) Gaps:46/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :::||:|||||||||.||||.||::|.|:||||:||||||||||||||                 
Zfish     6 LDVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLE----------------- 53

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
                                         ||||||||||||||.|||||||||||||||||||||
Zfish    54 -----------------------------LETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 89

  Fly   135 YDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            |||||||::|||||||||||||||:|||||||||||||||||||.||||||||||||||||.|||
Zfish    90 YDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 154

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            |||||||||||..|||||||||||||||:||:|||.:|:.||||||||||||||||||||.||||
Zfish   155 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 219

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            ||||||||||||||.|||||:|||||||||||::|:.|
Zfish   220 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 216/289 (75%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 218/293 (74%)
MPP_superfamily 7..251 CDD:301300 216/289 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.