DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:313 Identity:122/313 - (38%)
Similarity:174/313 - (55%) Gaps:41/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLEVRGARPGK-NVQL------SEGEIR----------GLCLKSREIFLSQPILLELEAPLKICG 61
            |.||...|.|| |.:|      .||.|.          |..|..:|     ..::::|||:.:||
  Fly    96 LAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQE-----KTMIDIEAPVTVCG 155

  Fly    62 DIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECA 126
            |||||:|||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.|.:..|||||||||.
  Fly   156 DIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECR 220

  Fly   127 SINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPT 191
            .:...:.|..|||.:||.:::....|.|:|||:||:::::..|.||||||::..:|.|||:.|..
  Fly   221 HLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFK 285

  Fly   192 DVPDQGLLCDLLWSDPDKDTMGWGEND-------RGVSFTFGAEVVAKFLQKHEFDLICRAHQVV 249
            :.|..|.:||||||||.:|......:|       ||.|:.:.......|||.:....|.|||:..
  Fly   286 EPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQ 350

  Fly   250 EDGYEFFAKRM------LVTLFSAPNYCGEFDNAGAMMSVDDTLM------CS 290
            :.||..:.|..      |:|:||||||...::|..|::..::.:|      ||
  Fly   351 DAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 122/313 (39%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 116/302 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.