DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and pzh1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_593373.1 Gene:pzh1 / 2542255 PomBaseID:SPAC57A7.08 Length:515 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:197/296 - (66%)
Similarity:232/296 - (78%) Gaps:1/296 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGAR-PGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYY 68
            :|:|.:|.||:.|..:| ..|:|.|...||..:|:..||||||||.||||..|:||.||:||||.
pombe   190 LNVDEMIQRLIHVGYSRKSSKSVCLKNAEITSICMAVREIFLSQPTLLELTPPVKIVGDVHGQYS 254

  Fly    69 DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYG 133
            ||:||||..||||.||||||||||||||||||||.||..|||:|.|||||||||||||:|.|:||
pombe   255 DLIRLFEMCGFPPSSNYLFLGDYVDRGKQSLETILLLFLYKIRYPENFFLLRGNHECANITRVYG 319

  Fly   134 FYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGL 198
            ||||||||.:||:||||.:.|||||:|::|..||||.||||||.|:.|:.||.|.|||||||.||
pombe   320 FYDECKRRCNIKIWKTFINTFNCLPIASVVAGKIFCVHGGLSPSLSHMDDIREIPRPTDVPDYGL 384

  Fly   199 LCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVT 263
            |.|||||||......|.:|:|||||.|...|:.:||.||:||||||||.|||||||||..|.|.|
pombe   385 LNDLLWSDPADTENDWEDNERGVSFVFNKNVIRQFLAKHDFDLICRAHMVVEDGYEFFNDRTLCT 449

  Fly   264 LFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADK 299
            :||||||||||||.||:|||:..|:|||:::||.|:
pombe   450 VFSAPNYCGEFDNWGAVMSVNSELLCSFELIKPLDQ 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 194/290 (67%)
pzh1NP_593373.1 PTZ00480 190..486 CDD:185658 197/296 (67%)
MPP_PP1_PPKL 191..482 CDD:277359 194/290 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.