DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppp2cb

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_058736.1 Gene:Ppp2cb / 24673 RGDID:3381 Length:309 Species:Rattus norvegicus


Alignment Length:295 Identity:138/295 - (46%)
Similarity:196/295 - (66%) Gaps:10/295 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL 71
            :|..:.:|.|.:        ||:|.::|.||.|::||...:..:.|:..|:.:|||:|||::||:
  Rat    10 LDQWVEQLNECK--------QLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLM 66

  Fly    72 RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYD 136
            .||..||..|::||||:|||||||..|:||:.||:|.|::|.|...:||||||...|.::|||||
  Rat    67 ELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYD 131

  Fly   137 ECKRRY-SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLC 200
            ||.|:| :..:||.|||.|:.||:.|:||.:|||.||||||.:.:::.||.:.|..:||.:|.:|
  Rat   132 ECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMC 196

  Fly   201 DLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLF 265
            |||||||| |..|||.:.||..:|||.::...|...:...|:.||||:|.:||.:...|.:||:|
  Rat   197 DLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIF 260

  Fly   266 SAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300
            ||||||....|..|:|.:||||..||....||.:|
  Rat   261 SAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 135/289 (47%)
Ppp2cbNP_058736.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 136/291 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.