DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppp3ca

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_032939.1 Gene:Ppp3ca / 19055 MGIID:107164 Length:521 Species:Mus musculus


Alignment Length:289 Identity:111/289 - (38%)
Similarity:168/289 - (58%) Gaps:25/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFL 88
            |..:|.|.....:..:...|...:..||:::||:.:|||||||::||::|||.||.|..:.||||
Mouse    52 KEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFL 116

  Fly    89 GDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDC 153
            |||||||..|:|.:..|.|.||.|.:..|||||||||..:...:.|..|||.:||.:::....|.
Mouse   117 GDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDA 181

  Fly   154 FNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGEND 218
            |:|||:||:::::..|.||||||::.:::.||::.|..:.|..|.:||:|||||.:|   :|...
Mouse   182 FDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLED---FGNEK 243

  Fly   219 ----------RGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRM------LVTLFSA 267
                      ||.|:.:....|..|||.:....|.|||:..:.||..:.|..      |:|:|||
Mouse   244 TQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSA 308

  Fly   268 PNYCGEFDNAGAMMSVDDTLM------CS 290
            |||...::|..|::..::.:|      ||
Mouse   309 PNYLDVYNNKAAVLKYENNVMNIRQFNCS 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 111/289 (38%)
Ppp3caNP_032939.1 MPP_PP2B 41..345 CDD:277361 111/289 (38%)
Catalytic. /evidence=ECO:0000305 56..340 110/285 (39%)
SAPNY motif. /evidence=ECO:0000250|UniProtKB:Q08209 307..311 3/3 (100%)
Interaction with PxIxIF motif in substrate. /evidence=ECO:0000250|UniProtKB:Q08209 327..336 1/8 (13%)
Calcineurin B binding. /evidence=ECO:0000269|PubMed:26794871 341..369
Calmodulin-binding. /evidence=ECO:0000269|PubMed:26794871 392..406
Autoinhibitory segment. /evidence=ECO:0000269|PubMed:26794871 407..414
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:26794871 465..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.